Proteintech, 27126-1-AP, CCDC90B Polyclonal antibody

Size: 20ul / 150ul The CCDC90B (27126-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC90B in WB, ELISA applications with reactivity to human, mouse, rat samples 27126-1-AP targets CCDC90B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, human placenta, mouse testis tissue, rat spleen tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information CCDC90B (Coiled-coil domain-containing protein 90B) is predicted to have a single-pass transmembrane domain located at its C-terminal. As two isoforms belong to the same protein family, CCDC90A/MCUR1 and CCDC90B show similar expression levels among tissues with few exceptions. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25934 Product name: Recombinant human CCDC90B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 146-246 aa of BC014573 Sequence: IELDQVKQQLMHETSRIRADNKLDINLERSRVTDMFTDQEKQLMETTTEFTKKDTQTKSIISETSNKIDAEIASLKTLMESNKLETIRYLAASVFTCLAIA Predict reactive species Full Name: coiled-coil domain containing 90B Observed Molecular Weight: 28 kDa GenBank Accession Number: BC014573 Gene Symbol: CCDC90B Gene ID (NCBI): 60492 RRID: AB_3669584 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9GZT6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.