Iright
BRAND / VENDOR: Proteintech

Proteintech, 27151-1-AP, DOCK4 Polyclonal antibody

CATALOG NUMBER: 27151-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DOCK4 (27151-1-AP) by Proteintech is a Polyclonal antibody targeting DOCK4 in WB, IF/ICC, ELISA applications with reactivity to human samples 27151-1-AP targets DOCK4 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25946 Product name: Recombinant human DOCK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1838-1971 aa of BC117689 Sequence: RPTQTASPARHTTSVSPSPAGRSPLKGSVQSFTPSPVEYHSPGLISNSPVLSGSYSSGISSLSRCSTSETSGFENQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPIPLPHSLSIPVTS Predict reactive species Full Name: dedicator of cytokinesis 4 Calculated Molecular Weight: 2011 aa, 230 kDa Observed Molecular Weight: 225 kDa GenBank Accession Number: BC117689 Gene Symbol: DOCK4 Gene ID (NCBI): 9732 RRID: AB_2880776 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N1I0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924