Proteintech, 27211-1-AP, CCDC114 Polyclonal antibody

Size: 20ul / 150ul The CCDC114 (27211-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC114 in WB, ELISA applications with reactivity to mouse, rat samples 27211-1-AP targets CCDC114 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26053 Product name: Recombinant human CCDC114 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_144577 Sequence: MEGERRAYSKEVHQRINKQLEEIRRLEEVRGDLQVQISAAQNQVKRLRDSQRLENMDRLLKGRAQVQAEIEELQEQTRALDKQIQEWETRIFTHSKNVRS Predict reactive species Full Name: coiled-coil domain containing 114 Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 65kDa GenBank Accession Number: NM_144577 Gene Symbol: CCDC114 Gene ID (NCBI): 93233 RRID: AB_3085937 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96M63 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.