Proteintech, 27213-1-AP, RHOA Polyclonal antibody

Size: 20ul / 150ul The RHOA (27213-1-AP) by Proteintech is a Polyclonal antibody targeting RHOA in WB, IHC, ELISA applications with reactivity to human, mouse samples 27213-1-AP targets RHOA in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RhoA is a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of RhoA is associated with tumor cell proliferation and metastasis. RhoA signalling is critical to many cellular processes including migration, mechanotransduction, and is often disrupted in carcinogenesis. Specification Tested Reactivity: human, mouse Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25873 Product name: Recombinant human RHOA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 123-161 aa of BC005976 Sequence: NDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSA Predict reactive species Full Name: ras homolog gene family, member A Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC005976 Gene Symbol: RHOA Gene ID (NCBI): 387 RRID: AB_2880803 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61586 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.