Iright
BRAND / VENDOR: Proteintech

Proteintech, 27232-1-AP, NMDAR1/GRIN1 Polyclonal antibody

CATALOG NUMBER: 27232-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NMDAR1/GRIN1 (27232-1-AP) by Proteintech is a Polyclonal antibody targeting NMDAR1/GRIN1 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 27232-1-AP targets NMDAR1/GRIN1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: rat brain tissue Positive IHC detected in: mouse brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information GRIN1 encodes subunit 1 of the N-methyl-D-aspartate (NMDA) receptor, which is a heteromeric glutamate-gated calcium ion channel essential for synaptic function in the brain (PMID: 25864721). NMDARs play important roles in normal brain development and function, such as synaptic plasticity, neural development, learning and memory (PMID: 20716669). NMDAR dysfunction has been associated with several neurological disorders including Parkinson, Alzheimer and Huntington diseases. Disrupted motor learning and long-term synaptic plasticity in mice lacking NMDAR1 in the striatum (PMID: 17015831). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26093 Product name: Recombinant human NMDAR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-120 aa of NM_000832 Sequence: MACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG Predict reactive species Full Name: glutamate receptor, ionotropic, N-methyl D-aspartate 1 Calculated Molecular Weight: 105 kDa Observed Molecular Weight: 116-120 kDa GenBank Accession Number: NM_000832 Gene Symbol: NMDAR1 Gene ID (NCBI): 2902 RRID: AB_3085939 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q05586 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924