Proteintech, 27272-1-AP, SHANK2 Polyclonal antibody

Size: 20ul / 150ul The SHANK2 (27272-1-AP) by Proteintech is a Polyclonal antibody targeting SHANK2 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 27272-1-AP targets SHANK2 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information SH3 and multiple ankyrin repeat domains protein 2 (SHANK2) is also named as CORTBP1, KIAA1022, PROSAP1. SHANK2 code a scaffolding protein located at the postsynaptic membrane of glutamatergic neurons (PMID: 32987185). SHANK2 encodes for a postsynaptic scaffolding protein at glutamatergic synapses in the brain, essential for proper synapse formation, development and plasticity (PMID: 11283303, PMID: 12065602). As SHANK2 directly interacts with IRSp53 (insulin receptor substrate p53), it may be involved in insulin signaling in the brain, making this pathway susceptible to SHANK2 mutations (PMID: 33483523). In the SFARI gene database, SHANK2 is categorized as a high confidence autism risk gene. In addition, SHANK2 has been linked to the pathology of neuropsychiatric (schizophrenia, bipolar disorder) and neurodegenerative disorders (PMID: 33483523). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26101 Product name: Recombinant human SHANK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 381-490 aa of NM_012309 Sequence: VDKASVRKKKDKPEEIVPASKPSRAAENMAVEPRVATIKQRPSSRCFPAGSDMNSVYERQGIAVMTPTVPGSPKAPFLGIPRGTMRRQKSIDSRIFLSGITEEERQFLAP Predict reactive species Full Name: SH3 and multiple ankyrin repeat domains 2 Calculated Molecular Weight: 159 kDa Observed Molecular Weight: 158-200 kDa GenBank Accession Number: NM_012309 Gene Symbol: SHANK2 Gene ID (NCBI): 22941 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UPX8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.