Proteintech, 27355-1-AP, AP50 Polyclonal antibody

Size: 20ul / 150ul The AP50 (27355-1-AP) by Proteintech is a Polyclonal antibody targeting AP50 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 27355-1-AP targets AP50 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, HepG2 cells, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26059 Product name: Recombinant human AP50 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC013796 Sequence: MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYE Predict reactive species Full Name: adaptor-related protein complex 2, mu 1 subunit Calculated Molecular Weight: 433 aa, 49 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC013796 Gene Symbol: AP50 Gene ID (NCBI): 1173 RRID: AB_2880853 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96CW1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.