Product Description
Size: 20ul / 150ul
The AP50 (27355-1-AP) by Proteintech is a Polyclonal antibody targeting AP50 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples
27355-1-AP targets AP50 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, HepG2 cells, rat brain tissue
Positive IP detected in: mouse brain tissue
Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2400
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag26059 Product name: Recombinant human AP50 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC013796 Sequence: MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYE Predict reactive species
Full Name: adaptor-related protein complex 2, mu 1 subunit
Calculated Molecular Weight: 433 aa, 49 kDa
Observed Molecular Weight: 50 kDa
GenBank Accession Number: BC013796
Gene Symbol: AP50
Gene ID (NCBI): 1173
RRID: AB_2880853
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96CW1
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924