Proteintech, 27420-1-AP, ELK1 Polyclonal antibody

Size: 20ul / 150ul The ELK1 (27420-1-AP) by Proteintech is a Polyclonal antibody targeting ELK1 in WB, ELISA applications with reactivity to human samples 27420-1-AP targets ELK1 in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, HeLa cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information ELK1 is a nuclear transcription factor of the ETS-domain family and the ternary complex factor (TCF) sub-family. It binds to purine-rich DNA sequences and forms a ternary complex with serum response factor (SRF) on the serum response element (SRE) located in the promoter regions of immediate early genes such as FOS and IER2. Upon activation of the JNK or MAPK/ERK signaling cascades, ELK1 is phosphorylated and rapidly induces target-gene transcription, thereby regulating cell proliferation, differentiation, and survival. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26683 Product name: Recombinant human ELK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 161-320 aa of BC056150 Sequence: TFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLE Predict reactive species Full Name: ELK1, member of ETS oncogene family Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: BC056150 Gene Symbol: ELK1 Gene ID (NCBI): 2002 RRID: AB_2880867 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P19419 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.