Proteintech, 27490-1-AP, PDXP Polyclonal antibody

Size: 20ul / 150ul The PDXP (27490-1-AP) by Proteintech is a Polyclonal antibody targeting PDXP in WB, IHC, ELISA applications with reactivity to Human, mouse samples 27490-1-AP targets PDXP in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, Neuro-2a cells, mouse brain tissue Positive IHC detected in: human liver tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PDXP, also named CIN, belongs to the HAD-like hydrolase superfamily. As a pyridoxal phosphate (PLP) phosphatase, PDXP can catalyzes the dephosphorylation of pyridoxine 5'-phosphate (PNP) and pyridoxamine 5'-phosphate (PMP), with order of substrate preference PLP > PNP > PMP and therefore plays a role in vitamin B6 metabolism. PDXP is highly expressed in all the regions of central nerve system except the spinal cord. PDXP is also expressed at high level in liver and testis. Specification Tested Reactivity: Human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26592 Product name: Recombinant human PDXP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 115-230 aa of BC064922 Sequence: GEGLRAELRAAGLRLAGDPSAGDGAAPRVRAVLVGYDEHFSFAKLREACAHLRDPECLLVATDRDPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSIDP Predict reactive species Full Name: pyridoxal (pyridoxine, vitamin B6) phosphatase Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC064922 Gene Symbol: PDXP Gene ID (NCBI): 57026 RRID: AB_2880887 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96GD0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.