Proteintech, 27686-1-AP, RCOR1 Polyclonal antibody

Size: 20ul / 150ul The RCOR1 (27686-1-AP) by Proteintech is a Polyclonal antibody targeting RCOR1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 27686-1-AP targets RCOR1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: C2C12 cell, PC-12 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information RCOR1, also named as REST corepressor 1, is a 485 amino acid protein, which belongs to the CoREST family. RCOR1 is a essential component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. The calculated molecular weight of RCOR1 is a 53 kDa, but the phosphorylated RCOR1 is about 60-65 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26770 Product name: Recombinant human RCOR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 245-310 aa of NM_015156 Sequence: MRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKP Predict reactive species Full Name: REST corepressor 1 Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: NM_015156 Gene Symbol: RCOR1 Gene ID (NCBI): 23186 RRID: AB_2880947 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKL0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.