Proteintech, 27707-1-AP, FTSJD2 Polyclonal antibody

Size: 20ul / 150ul The FTSJD2 (27707-1-AP) by Proteintech is a Polyclonal antibody targeting FTSJD2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 27707-1-AP targets FTSJD2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: U-251 cells, NIH/3T3 cells Positive IHC detected in: human testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Cap1 2′-O-methylation is catalyzed by cap methyltransferase 1 (CMTR1). CMTR1, also called IFN-stimulated gene 95 kDa protein (ISG95) or FTSJD2, is elevated by a viral infection and required to promote IFN-mediated induction of ISGs and the antiviral response. High CMTR1 expression is associated with poor prognosis in patients with CRC (PMID: 37024465). CMTr1 binds ATP-dependent RNA DHX15 helicase and that this interaction, mediated by the G-patch domain of CMTr1, has an advantageous effect on CMTr1 activity towards highly structured RNA substrates (PMID: 30397098).). Human CMTR1 is a 95 kDa nuclear protein that has multiple domains, consisting of a G-patch domain, a RrmJ/FtsJ methyltransferase domain, a non-functional cap guanylyltransferase-like domain and a WW domain (PMID: 30312682). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26722 Product name: Recombinant human FTSJD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 499-835 aa of BC031890 Sequence: SNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARVAPSSSDPKSKFFELIQGTEIDIFSYKPTLLTSKTLEKIRPVFDYRCMVSGSEQKFLIGLGKSQIYTWDGRQSDRWIKLDLKTELPRDTLLSVEIVHELKGEGKAQRKISAIHILDVLVLNGTDVREQHFNQRIQLAEKFVKAVSKPSRPDMNPIRVKEVYRLEEMEKIFVRLEMKIIKGSSGTPKLSYTGRDDRHFVPMGLYIVRTVNEPWTMGFSKSFKKKFFYNKKTKDSTFDLPADSIAPFHICYYGRLFWEWGDGIRVHDSQKPQDQDKLSKEDVLSFIQMHRA Predict reactive species Full Name: FtsJ methyltransferase domain containing 2 Calculated Molecular Weight: 835 aa, 95 kDa Observed Molecular Weight: 96-100 kDa GenBank Accession Number: BC031890 Gene Symbol: FTSJD2 Gene ID (NCBI): 23070 RRID: AB_2880949 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N1G2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.