Proteintech, 27761-1-AP, SALL1 Polyclonal antibody

Size: 20ul / 150ul The SALL1 (27761-1-AP) by Proteintech is a Polyclonal antibody targeting SALL1 in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 27761-1-AP targets SALL1 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse testis tissue, human placenta tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information SALL1(Sal-like protein 1), also known as SAL1. It is located in the cytoplasm and nucleus. The protein is mainly expressed in the kidney. Transcriptional repressor involved in organogenesis. The protein plays an essential role in ureteric bud invasion during kidney development. The molecular weight of SALL1 is 140 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26766 Product name: Recombinant human SALL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 558-670 aa of NM_001127892 Sequence: MPLPPTLPSLIPFIKTEEPAPIPISHSATSPPGSVKSDSGGPESATRNLGGLPEEAEGSTLPPSGGKSEESGMVTNSVPTASSSVLSSPAADCGPAGSATTFTNPLLPLMSEQF Predict reactive species Full Name: sal-like 1 (Drosophila) Calculated Molecular Weight: 140 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: NM_001127892 Gene Symbol: SALL1 Gene ID (NCBI): 6299 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NSC2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.