Proteintech, 27823-1-AP, CD107b / LAMP2 Polyclonal antibody

Size: 20ul / 150ul The CD107b / LAMP2 (27823-1-AP) by Proteintech is a Polyclonal antibody targeting CD107b / LAMP2 in WB, IHC, ELISA applications with reactivity to human, pig samples 27823-1-AP targets CD107b / LAMP2 in WB, IHC, IF, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: HepG2 cells, Jurkat cells, pig liver tissue, human placenta tissue Positive IHC detected in: human liver tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Lysosomal-associated membrane protein 2 (LAMP2, synonyms: LAMPB, CD107b) is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. LAMP2 may plays a role in tumor cell metastasis. It may also functions in the protection, maintenance, and adhesion of the lysosome. Prior to posttranslational modification, LAMP2 is a ~45 kDa polypeptide. Mature, functional LAMP2 is extensively glycosylated with a variety of different N linked and O linked oligosaccharides. Specification Tested Reactivity: human, pig Cited Reactivity: human, pig, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27183 Product name: Recombinant human LAMP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-230 aa of BC002965 Sequence: LELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGND Predict reactive species Full Name: lysosomal-associated membrane protein 2 Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC002965 Gene Symbol: LAMP2 Gene ID (NCBI): 3920 ENSEMBL Gene ID: ENSG00000005893 RRID: AB_2880983 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13473 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.