Proteintech, 27882-1-AP, PCSK9 Polyclonal antibody

Size: 20ul / 150ul The PCSK9 (27882-1-AP) by Proteintech is a Polyclonal antibody targeting PCSK9 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 27882-1-AP targets PCSK9 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, rat liver tissue, mouse liver tissue Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Proprotein convertase subtilisin/kexin type 9 (PCSK9) is a crucial protein governing the circulating levels of low density lipoprotein-cholesterol (LDL-C), by virtue of its pivotal role in the degradation of the LDL receptor (LDLR). PCSK9 is expressed in the kidney and lung. It is synthesized as a 72 kDa immature precursor that undergoes autocatalytic cleavage in the endoplasmic reticulum to generate a 63 kDa mature protein. The cleaved N-terminal fragment remains associated with the mature protein and is necessary for its secretion, allowing it to circulate in the blood. The ability of PCSK9 to regulate a diverse group of cell-surface proteins hinted that it might also be able to influence additional membrane proteins that are important in anti-tumour immune responses. Targeting PCSK9 to treat cancer is also attractive because two neutralizing antibodies against it, evolocumab and alirocumab, have already been approved for human clinical use to lower cholesterol levels. (PMID: 30522786, PMID: 22493497) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27254 Product name: Recombinant human PCSK9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 476-692 aa of NM_174936.3 Sequence: MRCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ Predict reactive species Full Name: proprotein convertase subtilisin/kexin type 9 Calculated Molecular Weight: 74 kDa Observed Molecular Weight: 72-78 kDa, 62 kDa GenBank Accession Number: NM_174936.3 Gene Symbol: PCSK9 Gene ID (NCBI): 255738 RRID: AB_2918134 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NBP7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.