Proteintech, 27885-1-AP, GRIA1 Polyclonal antibody

Size: 20ul / 150ul The GRIA1 (27885-1-AP) by Proteintech is a Polyclonal antibody targeting GRIA1 in WB, ELISA applications with reactivity to Human, Mouse, Pig, rat samples 27885-1-AP targets GRIA1 in WB, ELISA applications and shows reactivity with Human, Mouse, Pig, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, pig brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Specification Tested Reactivity: Human, Mouse, Pig, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27295 Product name: Recombinant human GRIA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 88-287 aa of BC111734 Sequence: FYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPK Predict reactive species Full Name: glutamate receptor, ionotropic, AMPA 1 Calculated Molecular Weight: 906 aa, 102 kDa Observed Molecular Weight: 102 kDa GenBank Accession Number: BC111734 Gene Symbol: GRIA1 Gene ID (NCBI): 2890 RRID: AB_3086003 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P42261 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.