Proteintech, 27903-1-AP, PIK3AP1 Polyclonal antibody

Size: 20ul / 150ul The PIK3AP1 (27903-1-AP) by Proteintech is a Polyclonal antibody targeting PIK3AP1 in WB, ELISA applications with reactivity to Human, Rat, Mouse samples 27903-1-AP targets PIK3AP1 in WB, ELISA applications and shows reactivity with Human, Rat, Mouse samples. Tested Applications Positive WB detected in: HT-29 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Phosphoinositide-3-kinase adaptor protein 1 (PIK3AP1), also known as B-cell adaptor for PI3K (BCAP), is a specific protein adaptor of B-cells that is expressed in hematopoietic cells. Besides, PIK3AP1 has been implicated in the development of gastric cancer. (PMID: 26121143, 28087538, 31078520) Specification Tested Reactivity: Human, Rat, Mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27398 Product name: Recombinant human PIK3AP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 634-794 aa of BC029917 Sequence: LNQKKRSESFRFQQENLKRLRDSITRRQREKQKSGKQTDLEITVPIRHSQHLPAKVEFGVYESGPRKSVIPPRTELRRGDWKTDSTSSTASSTSNRSSTRSLLSVSSGMEGDNEDNEVPEVTRSRSPGPPQVDGTPTMSLERPPRVPPRAASQRPPTRETF Predict reactive species Full Name: phosphoinositide-3-kinase adaptor protein 1 Calculated Molecular Weight: 90 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC029917 Gene Symbol: PIK3AP1 Gene ID (NCBI): 118788 RRID: AB_3086007 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZUJ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.