Product Description
Size: 20ul / 150ul
The C19orf62 (27926-1-AP) by Proteintech is a Polyclonal antibody targeting C19orf62 in WB, IHC, ELISA applications with reactivity to Human samples
27926-1-AP targets C19orf62 in WB, IHC, ELISA applications and shows reactivity with Human samples.
Tested Applications
Positive WB detected in: HeLa cells, HepG2 cells, U-251 cells
Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:5000
Immunohistochemistry (IHC): IHC : 1:250-1:1000
Specification
Tested Reactivity: Human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag27459 Product name: Recombinant human C19orf62 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-143 aa of BC000788 Sequence: SSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNALNVSQKMIEMFVRTKHKIDKSHE Predict reactive species
Full Name: chromosome 19 open reading frame 62
Calculated Molecular Weight: 329 aa, 37 kDa
Observed Molecular Weight: 37 kDa
GenBank Accession Number: BC000788
Gene Symbol: C19orf62
Gene ID (NCBI): 29086
RRID: AB_2881010
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9NWV8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924