Proteintech, 27956-1-AP, VE-cadherin/CD144 Polyclonal antibody

Size: 20ul / 150ul The VE-cadherin/CD144 (27956-1-AP) by Proteintech is a Polyclonal antibody targeting VE-cadherin/CD144 in WB, IHC, IF/ICC, FC, ELISA applications with reactivity to human samples 27956-1-AP targets VE-cadherin/CD144 in WB, IHC, IF/ICC, FC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells, human placenta tissue Positive IHC detected in: human placenta tissue, human breast cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HUVEC cells Positive FC detected in: HUVEC cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Cadherins are a family of transmembrane glycoproteins that mediate calcium-dependent cell-cell adhesion and play an important role in the maintenance of normal tissue architecture. Vascular endothelial cadherin (VE-cadherin), also known as Cadherin-5 (CDH5) or CD144, is a member of the type II classical cadherin family of cell adhesion proteins (PMID: 21269602). VE-cadherin is expressed specifically in endothelial cells and mediates homophilic adhesion in the vascular endothelium (PMID: 1522121; 8555485; 21269602). VE-cadherin plays a role in the organization of lateral endothelial junctions and in the control of permeability properties of vascular endothelium (PMID: 1522121). VE-cadherin has also been shown to be required for angiogenesis (PMID: 16473763; 18162609). The calculated molecular weight of VE-cadherin is 88 kDa and the apparent molecular weight of 120-140 kDa is higher due to post-translational glycosylation and phosphorylation (PMID: 10460833; 29894844). Full-length VE-cadherin can be proteolytically cleaved to generate a fragment of 90-100 kDa (PMID: 9786462; 22064597). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27487 Product name: Recombinant human CDH5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 54-241 aa of NM_001795 Sequence: MHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSGT Predict reactive species Full Name: cadherin 5, type 2 (vascular endothelium) Calculated Molecular Weight: 88 kDa Observed Molecular Weight: 120-140 kDa GenBank Accession Number: NM_001795 Gene Symbol: VE-cadherin Gene ID (NCBI): 1003 RRID: AB_2918136 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P33151 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.