Proteintech, 27988-1-AP, TOX4 Polyclonal antibody

Size: 20ul / 150ul The TOX4 (27988-1-AP) by Proteintech is a Polyclonal antibody targeting TOX4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 27988-1-AP targets TOX4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, K-562 cells, MCF-7 cells, PC-3 cells, Raji cells Positive IHC detected in: rat bladder tissue, mouse bladder tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Background Information TOX (Thymocyte selection-associated HMG bOX) genes represent a novel gene family and encode a novel nuclear DNA binding protein belonging to a large superfamily of HMG (high mobility group)-box family. TOX proteins consist a small subfamily of proteins, including TOX1, TOX2, TOX3, and TOX4. The TOX subfamily members are highly conserved among vertebrates. TOX4 was recently found to be one of the subunits of the PP1C, which consists of three regulatory proteins, PNUTS, TOX4, and WDR82, and one of the PP1 phosphatases, PP1α, β, andγ25. Tox4 can modulate cell fate by reprogramming from a somatic state into a pluripotent and neuronal fate (PMID:31519808). Despite a predicted molecular mass of TOX4 protein of 66 kDa, the detection band of western blot analysis in many literatures is 100 kDa (PMID:37286708;35365735). This antibody was also detected at around 100 kda. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27638 Product name: Recombinant human TOX4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 43-215 aa of BC013689 Sequence: SLDSDPSLAVSDVVGHFDDLADPSSSQDGSFSAQYGVQTLDMPVGMTHGLMEQGGGLLSGGLTMDLDHSIGTQYSANPPVTIDVPMTDMTSGLMGHSQLTTIDQSELSSQLGLSLGGGTILPPAQSPEDRLSTTPSPTSSLHEDGVEDFRRQLPSQKTVVVEAGKKQKAPKKR Predict reactive species Full Name: TOX high mobility group box family member 4 Calculated Molecular Weight: 621 aa, 66 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC013689 Gene Symbol: TOX4 Gene ID (NCBI): 9878 RRID: AB_3086019 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94842 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.