Proteintech, 28011-1-AP, C19orf26 Polyclonal antibody

Size: 20ul / 150ul The C19orf26 (28011-1-AP) by Proteintech is a Polyclonal antibody targeting C19orf26 in WB, ELISA applications with reactivity to human, mouse samples 28011-1-AP targets C19orf26 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: U2OS cells, LNCaP cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27725 Product name: Recombinant human C19orf26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 68-269 aa of BC028156 Sequence: LLCKRCWDVHQRLNRAMEEAEKTTTTYLDNGTHPAQDPDFRGEDPECQDAETERFLSTSSTGRRVSFNEAALFEQSRKTQDKGRRYTLTEGDFHHLKNARLTHLHLPPLKIVTIHECDSGEASSATTPHPATSPKATLAIFQPPGKALTGRSVGPSSALPGDPYNSAAGATDFAEISPSASSDSGEGTSLDAGTRSTKAGGP Predict reactive species Full Name: chromosome 19 open reading frame 26 Calculated Molecular Weight: 725 aa, 76 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC028156 Gene Symbol: C19orf26 Gene ID (NCBI): 255057 RRID: AB_3086020 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N350 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.