Proteintech, 28063-1-AP, Red fluorescent protein (RFP611) Polyclonal antibody

Size: 20ul / 150ul The Red fluorescent protein (RFP611) (28063-1-AP) by Proteintech is a Polyclonal antibody targeting Red fluorescent protein (RFP611) in WB, ELISA applications with reactivity to parasicyonis actinostoloides, recombinant protein samples 28063-1-AP targets Red fluorescent protein (RFP611) in WB, ELISA applications and shows reactivity with parasicyonis actinostoloides, recombinant protein samples. Tested Applications Positive WB detected in: Transfected HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Red fluorescent proteins (RFPs) is a collective term referring to a heterogenous group of red chromophore-carrying proteins, originating from various species and forming different protein lineages. The original RFP (dsRed) is a 225 amino acid fluorescent protein (25.9 kDa) derived from Discosoma sp.. It emits red light with a peak wavelength of 593 nm upon excitation by green light (excitation peak at 558 nm). When fused with other proteins, RFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy. This antibody is a rabbit polyclonal antibody raised against RFP from Entacmaea quadricolor (eqFP611). Specification Tested Reactivity: parasicyonis actinostoloides, recombinant protein Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27893 Product name: Recombinant entacmaea quadricolor Red fluorescent protein protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-231 aa of Sequence: MNSLIKENMRMMVVMEGSVNGYQFKCTGEGDGNPYMGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFIKHTKGIPDFFKQSFPEGFTWERVTRYEDGGVFTVMQDTSLEDGCLVYHAKVTGVNFPSNGAVMQKKTKGWEPNTEMLYPADGGLRGYSQMALNVDGGGYLSCSFETTYRSKKTVENFKMPGFHFVDHRLERLEESDKEMFVVQHEHAVAKFCDLPSKLGRL Predict reactive species Full Name: Red fluorescent protein (RFP611) Calculated Molecular Weight: 26 kDa RRID: AB_2918144 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8ISF8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.