Product Description
Size: 20ul / 150ul
The DLGAP1 (28124-1-AP) by Proteintech is a Polyclonal antibody targeting DLGAP1 in WB, ELISA applications with reactivity to Human, mouse, rat samples
28124-1-AP targets DLGAP1 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, rat brain tissue, rat cerebellum tissue
Recommended dilution
Western Blot (WB): WB : 1:2000-1:10000
Specification
Tested Reactivity: Human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag27182 Product name: Recombinant human DLGAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10-68 aa of BC070175 Sequence: HHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGPFSDPLASS Predict reactive species
Full Name: discs, large (Drosophila) homolog-associated protein 1
Calculated Molecular Weight: 543 aa, 60 kDa
Observed Molecular Weight: 110-130 kDa
GenBank Accession Number: BC070175
Gene Symbol: DLGAP1
Gene ID (NCBI): 9229
RRID: AB_3086030
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O14490
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924