Proteintech, 28239-1-AP, CXCR5 Polyclonal antibody

Size: 20ul / 150ul The CXCR5 (28239-1-AP) by Proteintech is a Polyclonal antibody targeting CXCR5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 28239-1-AP targets CXCR5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, mouse spleen tissue, rat spleen tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Initially discovered in 1992 as Burkitt's lymphoma receptor 1, CXCR5 (chemokine receptor 5, also known as CD185) is a seven-transmembrane G protein-coupled receptor (GPCR) protein (PMID: 32994482). CXCR5 is essential for naïve B-cell migration to and maturation in the lymph nodes and spleen, as well as for cluster of differentiation 4 T-cell (TFH and TCM) homing and interaction with B cells (PMID: 21471443). Moreover, CXCR5 is involved in the regulation of neural stem cells (NSC) and neuronal regeneration in the mouse brain, neuronal differentiation, neurogenesis, gliogenesis, and synaptogenesis (PMID: 37460877). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28271 Product name: Recombinant human CXCR5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 241-372 aa of NM_001716 Sequence: MVVHRLRQAQRRPQRQKAVRVAILVTSIFFLCWSPYHIVIFLDTLARLKAVDNTCKLNGSLPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSLSESENATSLTTF Predict reactive species Full Name: chemokine (C-X-C motif) receptor 5 Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: NM_001716 Gene Symbol: CXCR5 Gene ID (NCBI): 643 RRID: AB_3086040 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P32302 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.