Proteintech, 28240-1-AP, RAB43 Polyclonal antibody

Size: 20ul / 150ul The RAB43 (28240-1-AP) by Proteintech is a Polyclonal antibody targeting RAB43 in WB, ELISA applications with reactivity to Human samples 28240-1-AP targets RAB43 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26911 Product name: Recombinant human RAB43 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 91-212 aa of BC062319 Sequence: ANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC Predict reactive species Full Name: RAB43, member RAS oncogene family Calculated Molecular Weight: 212 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC062319 Gene Symbol: RAB43 Gene ID (NCBI): 339122 RRID: AB_2881095 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86YS6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.