Iright
BRAND / VENDOR: Proteintech

Proteintech, 28245-1-AP, GLI2-Specific Polyclonal antibody

CATALOG NUMBER: 28245-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GLI2-Specific (28245-1-AP) by Proteintech is a Polyclonal antibody targeting GLI2-Specific in WB, IHC, ELISA applications with reactivity to human samples 28245-1-AP targets GLI2-Specific in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, U2OS cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GLI2, along with the related GLI1 and GLI3, is a member of the GLI family of transcription factors belonging to the Glis superfamily. Glioma-Associated Oncogene Family Zinc Finger 2 (GLI2) is a zinc-finger transcription factor involved in the Sonic Hedgehog pathway. GLI2 is involved in proliferation, invasion, fibrosis, and is involved in carcinogenesis in various malignancies including gastric cancer, lung cancer, prostate cancer, bladder cancer, and so on. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28422 Product name: Recombinant human GLI2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 601-795 aa of NM_005270 Sequence: NDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTESSGLCQSSPGAQSSCSSEPSPLGSAPNNDSGVEMPGTGPGSLGDLTALDDTPPGADTSALAAPSAGGLQLRKHMTTMHRFEQLKKEKLKSLKDSCSWAGPTPHTRNTKLPPLPGSGSILENFSGSGGGGPAGLLPNPRLSELSASE Predict reactive species Full Name: GLI family zinc finger 2 Calculated Molecular Weight: 168 aa Observed Molecular Weight: 180-200 kDa GenBank Accession Number: NM_005270 Gene Symbol: GLI2 Gene ID (NCBI): 2736 RRID: AB_3086041 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10070 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924