Proteintech, 28323-1-AP, ADRB1 Polyclonal antibody

Size: 20ul / 150ul The ADRB1 (28323-1-AP) by Proteintech is a Polyclonal antibody targeting ADRB1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 28323-1-AP targets ADRB1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ADRB1 (adrenergic receptor beta 1), a member of the G protein-coupled receptor (GPCR) superfamily, responds to catecholamine stimulation. ADRB1 is the predominant subtype expressed in the heart and mediates increases in inotropy and chronotropy when stimulated. ADRB1 mediates a wide range of cardiovascular physiological responses and has been of great interest to researchers as a therapeutic target for cardiovascular diseases. Moreover, three subtypes of ADRBs (ADRB1, ADRB2, and ADRB3) are encoded by three separate genes (PMID:16636683; 33372534; 33593484). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28223 Product name: Recombinant human ADRB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 388-477 aa of NM_000684 Sequence: MQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV Predict reactive species Full Name: adrenergic, beta-1-, receptor Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: NM_000684 Gene Symbol: ADRB1 Gene ID (NCBI): 153 RRID: AB_3086044 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08588 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.