Iright
BRAND / VENDOR: Proteintech

Proteintech, 28367-1-AP, ST6GAL2 Polyclonal antibody

CATALOG NUMBER: 28367-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ST6GAL2 (28367-1-AP) by Proteintech is a Polyclonal antibody targeting ST6GAL2 in WB, ELISA applications with reactivity to Human, Mouse samples 28367-1-AP targets ST6GAL2 in WB, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: HL-60 cells, RAW 264.7 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:300-1:800 Specification Tested Reactivity: Human, Mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26357 Product name: Recombinant human ST6GAL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-200 aa of BC008680 Sequence: SNPAEPVPSSLSFLETRRLLPVQGKQRAIMGAAHEPSPPGGLDARQALPRAHPAGSFHAGPGDLQKWAQSQDGFEHKEFFSSQVGRKSQSAFYPEDDDYFFAAGQPGWHSHTQGTLGFPSPGEPGPREGAFPAAQVQRRRVKKRHRRQRRSHVLEEGDDGDRLYSSMSRAFLYRLWKGN Predict reactive species Full Name: ST6 beta-galactosamide alpha-2,6-sialyltranferase 2 Calculated Molecular Weight: 529 aa, 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC008680 Gene Symbol: ST6GAL2 Gene ID (NCBI): 84620 RRID: AB_2881124 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96JF0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924