Proteintech, 28380-1-AP, FNIP1 Polyclonal antibody

Size: 20ul / 150ul The FNIP1 (28380-1-AP) by Proteintech is a Polyclonal antibody targeting FNIP1 in WB, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 28380-1-AP targets FNIP1 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Positive IF/ICC detected in: C2C12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Folliculin-interacting protein 1 (FNIP1) forms a complex with the protein folliculin (FLCN), together acting as guanosine triphosphate (GTP)-activating protein (GAP) for RagC. The FNIP1-FLCN complex has emerged as an amino acid sensor to the mechanistic target of rapamycin complex 1 (mTORC1), involved in how amino acids control TFEB activation. AMPK phosphorylation of FNIP1 induces lysosomal and mitochondrial biogenesis (PMID: 37079666) Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28976 Product name: Recombinant human FNIP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 163-250 aa of BC001956 Sequence: FTARTGSSICGSLNTLQDSLEFINQDNNTLKADNNTVINGLLGNIGLSQFCSPRRAFSEQGPLRLIRSASFFAVHSNPMDMPGRELNE Predict reactive species Full Name: folliculin interacting protein 1 Calculated Molecular Weight: 508 aa, 57 kDa Observed Molecular Weight: 130-150 kDa GenBank Accession Number: BC001956 Gene Symbol: FNIP1 Gene ID (NCBI): 96459 RRID: AB_2881128 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TF40 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.