Proteintech, 28599-1-AP, TAC1/Substance P Polyclonal antibody

Size: 20ul / 150ul The TAC1/Substance P (28599-1-AP) by Proteintech is a Polyclonal antibody targeting TAC1/Substance P in IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 28599-1-AP targets TAC1/Substance P in IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse brain tissue, human hypothalamus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: PC-12 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information TAC1, also known as Protachykinin-1, is a gene that encodes for a family of neuropeptides known as tachykinins. These peptides are characterized by their ability to rapidly stimulate contraction of intestinal muscle, hence the name "tachykinins". The TAC1 gene and its products are widely distributed in the nervous system, with α-TAC1 mRNA localized in numerous neurons of the brain. β-TAC1 and γ-TAC1 are predominantly expressed in intrinsic enteric neurons and sensory neurons. Additionally, the expression of TAC1, SP, and NKA is observed in various peripheral neurons and non-neural tissues such as the salivary gland, heart, skin, spleen, adrenal gland, and more. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23477 Product name: Recombinant human TAC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 20-89 aa of BC018047 Sequence: EEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYG Predict reactive species Full Name: tachykinin, precursor 1 Calculated Molecular Weight: 129 aa, 15 kDa GenBank Accession Number: BC018047 Gene Symbol: TAC1 Gene ID (NCBI): 6863 RRID: AB_2881178 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20366 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.