Iright
BRAND / VENDOR: Proteintech

Proteintech, 28625-1-AP, SARM1 Polyclonal antibody

CATALOG NUMBER: 28625-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SARM1 (28625-1-AP) by Proteintech is a Polyclonal antibody targeting SARM1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 28625-1-AP targets SARM1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Daudi cells, HEK-293 cells, Neuro-2a cells, Raji cells, human testis tissue, SH-SY5Y cells, mouse brain tissue, rat brain tissue Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Positive FC (Intra) detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information SARM1 (sterile alpha and Toll/interleukin-1 receptor motif-containing 1) is also named as KIAA0524, SAMD2 and SARM. SARM1 is the major pro-degenerative protein in axons (PMID: 32152523). SARM1 is the central executioner of pathological axon degeneration and is an inducible NAD+-cleavage enzyme that is activated by the loss of the NAD+ biosynthetic enzyme NMNAT2 (PMID: 33657413). SARM1 is involved in innate immune response: inhibits both TICAM1/TRIF- and MYD88-dependent activation of JUN/AP-1, TRIF-dependent activation of NF-kappa-B and IRF3, and the phosphorylation of MAPK14/p38 (PMID: 16964262). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29531 Product name: Recombinant human SARM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 352-573 aa of NM_015077 Sequence: EAAIKSLQGKTKVFSDIGAIQSLKRLVSYSTNGTKSALAKRALRLLGEEVPRPILPSVPSWKEAEVQTWLQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYSTCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGDTPDVFISYRRNSG Predict reactive species Full Name: sterile alpha and TIR motif containing 1 Calculated Molecular Weight: 79 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: NM_015077 Gene Symbol: SARM1 Gene ID (NCBI): 23098 RRID: AB_3086070 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6SZW1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924