Proteintech, 28678-1-AP, SCD1 Polyclonal antibody

Size: 20ul / 150ul The SCD1 (28678-1-AP) by Proteintech is a Polyclonal antibody targeting SCD1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 28678-1-AP targets SCD1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, A375 cells, A549 cells, HepG2 cells Positive IHC detected in: mouse liver tissue, human liver tissue, mouse brown adipose tissue, human colon cancer tissue, human ovary tumor tissue, human stomach cancer tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SCD1 (stearoyl-CoA desaturase) is a microsomal fatty acid monodesaturase, which catalyses the committed step in the biosynthesis of mono-unsaturated fatty acids from saturated fatty acids (PMID:10946019). SCD1 and SCD2 are the main isoforms expressed in mouse liver and brain respectively (PMID:15907797). The formation of homodimers and oligomers is an intrinsic property of SCD proteins. SCD1 is a multi-pass membrane protein and detected double bands of 37-42 kDa. The degradation product of 28 kDa may be caused by a major cleavage site at the C-terminus (PMID:15610069, PMID: 9843580). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29156 Product name: Recombinant human SCD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC005807 Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYV Predict reactive species Full Name: stearoyl-CoA desaturase (delta-9-desaturase) Calculated Molecular Weight: 355 aa, 41 kDa Observed Molecular Weight: 28-42 kDa GenBank Accession Number: BC005807 Gene Symbol: SCD Gene ID (NCBI): 6319 RRID: AB_2923581 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00767 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.