Proteintech, 28713-1-AP, TAF9B Polyclonal antibody

Size: 20ul / 150ul The TAF9B (28713-1-AP) by Proteintech is a Polyclonal antibody targeting TAF9B in WB, IP, IHC, ELISA applications with reactivity to Human, mouse samples 28713-1-AP targets TAF9B in WB, IP, IHC, CoIP, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, K-562 cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Transcription initiation factor TFIID subunit 9B (TAF9B), also names neuronal cell death-related protein 7, transcription initiation factor TFIID subunit 9-like, transcription-associated factor TAFII31L. It is essential for cell viability. TAF9 and TAF9B are involved in transcriptional activation as well as repression of distinct but overlapping sets of genes, may have a role in gene regulation associated with apoptosis. TAFs are components of the transcription factor IID (TFIID) complex, the TBP-free TAFII complex (TFTC), the PCAF histone acetylase complex and the STAGA transcription coactivator-HAT complex. TFIID or TFTC are essential for the regulation of RNA polymerase II-mediated transcription. The calculated MW of TAF9B is 28 kDa, 28713-1-AP can detect a band around 30 kDa. Specification Tested Reactivity: Human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29633 Product name: Recombinant human TAF9B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 133-200 aa of BC010350 Sequence: IKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPA Predict reactive species Full Name: TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC010350 Gene Symbol: TAF9B Gene ID (NCBI): 51616 RRID: AB_3086081 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HBM6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.