Proteintech, 28751-1-AP, TRIM27 Polyclonal antibody

Size: 20ul / 150ul The TRIM27 (28751-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM27 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples 28751-1-AP targets TRIM27 in WB, IF, IHC, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, Raji cells Positive IHC detected in: human colon cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human, Mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30576 Product name: Recombinant human TRIM27 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 233-352 aa of BC013580 Sequence: IAQLEEKQQQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQSDMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPE Predict reactive species Full Name: tripartite motif-containing 27 Calculated Molecular Weight: 513 aa, 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC013580 Gene Symbol: TRIM27 Gene ID (NCBI): 5987 RRID: AB_2881207 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14373 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.