Proteintech, 28752-1-AP, MOG Polyclonal antibody

Size: 20ul / 150ul The MOG (28752-1-AP) by Proteintech is a Polyclonal antibody targeting MOG in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 28752-1-AP targets MOG in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat cerebellum tissue, mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30377 Product name: Recombinant human MOG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-154 aa of BC035938 Sequence: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG Predict reactive species Full Name: myelin oligodendrocyte glycoprotein Calculated Molecular Weight: 295 aa, 34 kDa Observed Molecular Weight: 25-28 kDa GenBank Accession Number: BC035938 Gene Symbol: MOG Gene ID (NCBI): 4340 RRID: AB_2881208 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16653 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.