Proteintech, 29253-1-AP, KLHL14 Polyclonal antibody

Size: 20ul / 150ul The KLHL14 (29253-1-AP) by Proteintech is a Polyclonal antibody targeting KLHL14 in WB, IF/ICC, ELISA applications with reactivity to human samples 29253-1-AP targets KLHL14 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: mouse kidney tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Kelch-like protein 14 (KLHL14) is a member of the KLHL family. The kelch motif was initially discovered in Kelch. In this protein there are six copies of the motif. It has been shown for one member that it is related to Galactose Oxidase for which a structure has been solved. Two isoforms of this protein exist - 70kDa and 43kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29188 Product name: Recombinant human KLHL14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-218 aa of BC021267 Sequence: MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAVLASCSQYFRSLFSSHPPLGGGVGGQDGLGAPKDQQQPPQQQPSQQQQPPPQEEPGTPSSSPDDKLLTSPRAINNLVLQGCSSIGLRLVLEYLYTANVTLSLDTVEEVLSVSKILHIPQVTKLCVQFLNDQISVQNYKQVCKIAALHGLEETKKLANKYLVEDVLLLNF Predict reactive species Full Name: kelch-like 14 (Drosophila) Calculated Molecular Weight: 44 kDa, 71 kDa Observed Molecular Weight: 43 kDa, 70 kDa GenBank Accession Number: BC021267 Gene Symbol: KLHL14 Gene ID (NCBI): 57565 RRID: AB_3669680 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P2G3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.