Proteintech, 29282-1-AP, HOMER2 Polyclonal antibody

Size: 20ul / 150ul The HOMER2 (29282-1-AP) by Proteintech is a Polyclonal antibody targeting HOMER2 in WB, ELISA applications with reactivity to human samples 29282-1-AP targets HOMER2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, LNCaP cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29718 Product name: Recombinant human HOMER2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 150-343 aa of BC012109 Sequence: HLKSENDKLKIALTQSAANVKKWEIELQTLRESNARLTTALQESAASVEQWKRQFSICRDENDRLRNKIDELEEQCSEINREKEKNTQLKRRIEELEAELREKETELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKLGTDN Predict reactive species Full Name: homer homolog 2 (Drosophila) Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 38-40 kDa GenBank Accession Number: BC012109 Gene Symbol: HOMER2 Gene ID (NCBI): 9455 RRID: AB_2918267 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NSB8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.