Proteintech, 29323-1-AP, STK11/LKB1 Polyclonal antibody

Size: 20ul / 150ul The STK11/LKB1 (29323-1-AP) by Proteintech is a Polyclonal antibody targeting STK11/LKB1 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples 29323-1-AP targets STK11/LKB1 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: A431 cells, MCF-7 cells, HEK-293T cells Positive IHC detected in: human lung cancer tissue, human breast cancer tissue, mouse testis tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information STK11(serine/threonine-protein kinase 11) is also named as LKB1, PJS, and belongs to the protein kinase superfamily. It controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. The tumour suppressor protein LKB1 is a serine/threonine kinase that has been causally linked to Peutz-Jeghers syndrome (PJS). Defects in STK11 are a cause of Peutz-Jeghers syndrome (PJS) and defects in STK11 have been associated with testicular germ cell tumor (TGCT) and some sporadic cancers, especially lung cancers. STK11 has 2 isoforms with MW of 49 kDa and 45 kDa, and can be detected as 50-54 kDa after posttranslational modification. Specification Tested Reactivity: Human, Mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30903 Product name: Recombinant human STK11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-428 aa of BC007981 Sequence: PLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLS Predict reactive species Full Name: serine/threonine kinase 11 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC007981 Gene Symbol: LKB1 Gene ID (NCBI): 6794 RRID: AB_2923591 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15831 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.