Iright
BRAND / VENDOR: Proteintech

Proteintech, 29364-1-AP, WDR47 Polyclonal antibody

CATALOG NUMBER: 29364-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WDR47 (29364-1-AP) by Proteintech is a Polyclonal antibody targeting WDR47 in WB, ELISA applications with reactivity to Human samples 29364-1-AP targets WDR47 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30853 Product name: Recombinant human WDR47 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 148-420 aa of BC039254 Sequence: IPADRKLSEAGFKASNNRLFQLVMKGLLYECCVEFCQSKATGEEITESEVLLGIDLLCGNGCDDLDLSLLSWLQNLPSSVFSCAFEQKMLNIHVDKLLKPTKAAYADLLTPLISKLSPYPSSPMRRPQSADAYMTRSLNPALDGLTCGLTSHDKRISDLGNKTSPMSHSFANFHYPGVQNLSRSLMLENTECHSIYEESPERDTPVDAQRPIGSEILGQSSVSEKEPANGAQNPGPAKQEKNELRDSTEQFQEYYRQRLRYQQHLEQKEQQRQ Predict reactive species Full Name: WD repeat domain 47 Calculated Molecular Weight: 919 aa, 102 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC039254 Gene Symbol: WDR47 Gene ID (NCBI): 22911 RRID: AB_2918284 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94967 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924