Proteintech, 29441-1-AP, YTHDC1 Polyclonal antibody

Size: 20ul / 150ul The YTHDC1 (29441-1-AP) by Proteintech is a Polyclonal antibody targeting YTHDC1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 29441-1-AP targets YTHDC1 in WB, IHC, IF, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, HSC-T6 cells, NIH/3T3 cells, MDA-MB-231 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information YTHDC1, containing 1 YTH domain, is one of the m6A-binding proteins that can recognize and bind to the m6A methylation site and plays a specific role in gene expression. YTHDC1 is constitutively enriched in the nucleus. It regulates mRNA splicing by bridging the interactions between the trans- and cis-regulatory elements to bind targeted mRNAs. YTHDC1 mediates the export of m6A modified mRNA from the nucleus to the cytoplasm by interacting with SRSF3, which is an essential factor driving the tumorigenic process in various types of cancers including breast cancer, colon cancer, ovarian cancer, osteosarcoma, and glioblastoma (32368386). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31459 Product name: Recombinant human YTHDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC053863 Sequence: MAADSREEKDGELNVLDDILTEVPEQDDELYNPESEQDKNEKKGSKRKSDRMESTDTKRQKPSVHSRQLVSKPLSSSVSNNKRIVSTKGKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKRDPERRAKSPTPDGSERIGLEVDRRASRSSQSSKEEVNSEEYG Predict reactive species Full Name: YTH domain containing 1 Calculated Molecular Weight: 85 kDa Observed Molecular Weight: ~100 kDa GenBank Accession Number: BC053863 Gene Symbol: YTHDC1 Gene ID (NCBI): 91746 RRID: AB_2918307 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96MU7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.