Proteintech, 29599-1-AP, TMEM66 Polyclonal antibody

Size: 20ul / 150ul The TMEM66 (29599-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM66 in IHC, ELISA applications with reactivity to human, mouse samples 29599-1-AP targets TMEM66 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse pancreas tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TMEM66/SOCE-associated regulatory factor (SARAF) is an endoplasmic reticulum (ER)-resident transmembrane protein that promotes SOCE inactivation and prevents Ca2+ overfilling of the cell. TMEM66 plays a key role in shaping cytosolic Ca2+ signals and determining the content of the major intracellular Ca2+ stores, which is probably important in protecting the cell from Ca2+ overfilling (PMID: 37007714). TMEM66 is a highly conserved protein in vertebrates. In mammals, TMEM66 is ubiquitously expressed, but has significantly high transcript levels in the immune and neuronal tissues (PMID: 25469256). Moreover, TMEM66 is an androgen-responsive marker for prostate cancer and mTOR-dependent cardiac growth (PMID:32173353). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29388 Product name: Recombinant human TMEM66 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-183 aa of BC015012 Sequence: NDPDRMLLRDVKALTLHYDRYTTSRRLDPIPQLKCVGGTAGCDSYTPKVIQCQNKGWDGYDVQWECKTDLDIAYKFGKTVVSCEGYESSEDQYVLRGSCGLEYNLDYTELGLQKLKESGKQHGFASFSDYYYKWSSADSCNMSGLITIVVLL Predict reactive species Full Name: transmembrane protein 66 Calculated Molecular Weight: 339 aa, 37 kDa GenBank Accession Number: BC015012 Gene Symbol: TMEM66 Gene ID (NCBI): 51669 RRID: AB_3086144 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96BY9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.