Proteintech, 29601-1-AP, RELB Polyclonal antibody

Size: 20ul / 150ul The RELB (29601-1-AP) by Proteintech is a Polyclonal antibody targeting RELB in WB, IHC, IP, ELISA applications with reactivity to human samples 29601-1-AP targets RELB in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, Ramos cells Positive IP detected in: Raji cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RELB is one of the more unusual members of the NF-κB family, it is best known for its roles in lymphoid development, DC biology, and noncanonical signaling. RELB is capable of direct binding to the AhR that supports the xenobiotic-detoxifying pathway. RELB can regulate the circadian rhythm by directly binding to the BMAL partner of CLOCK. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30334 Product name: Recombinant human RELB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 375-446 aa of BC028013 Sequence: VTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLGELNSSDPHGIESKRRKKKPAILDHFL Predict reactive species Full Name: v-rel reticuloendotheliosis viral oncogene homolog B Calculated Molecular Weight: 62 kDa Observed Molecular Weight: 62-65 kDa GenBank Accession Number: BC028013 Gene Symbol: RELB Gene ID (NCBI): 5971 RRID: AB_2918330 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q01201 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.