Proteintech, 29752-1-AP, SHH Polyclonal antibody

Size: 20ul / 150ul The SHH (29752-1-AP) by Proteintech is a Polyclonal antibody targeting SHH in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 29752-1-AP targets SHH in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, MDA-MB-231 cells, mouse liver tissue, rat liver tissue Positive IHC detected in: mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information SHH, Sonic hedgehog protein, binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes (PMID: 10753901). In the absence of SHH, PTCH1 represses the constitutive signaling activity of SMO (PMID: 10753901). SHH is synthesized as a 45 kDa precursor that undergoes an autocatalytic processing event that produces a 19 kDa N-terminal product, responsible for all signaling activities, and a 25 kDa C-terminal fragment (PMID: 10753901, PMID: 16282375). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31338 Product name: Recombinant human SHH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-123 aa of NM_000193 Sequence: CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRV Predict reactive species Full Name: sonic hedgehog homolog (Drosophila) Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: NM_000193 Gene Symbol: SHH Gene ID (NCBI): 6469 RRID: AB_2935475 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15465 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.