Proteintech, 29765-1-AP, POLD2 Polyclonal antibody

Size: 20ul / 150ul The POLD2 (29765-1-AP) by Proteintech is a Polyclonal antibody targeting POLD2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 29765-1-AP targets POLD2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, NIH/3T3 cells, HeLa cells, Jurkat cells, SGC-7901 cells, U-251 cells, mouse colon tissue, mouse pancreas tissue, rat colon tissue Positive IHC detected in: human colon tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information POLD2, also named as DNA polymerase delta subunit 2, is a 469 amino acid protein, which belongs to the DNA polymerase delta/II small subunit family. The function of the small subunit is not yet clear. POLD2 has an essential function for the small subunit in the heterodimeric core enzyme. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31521 Product name: Recombinant human POLD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 40-195 aa of BC000459 Sequence: RLGERSFSRQYAHIYATRLIQMRPFLENRAQQHWGSGVGVKKLCELQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRF Predict reactive species Full Name: polymerase (DNA directed), delta 2, regulatory subunit 50kDa Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 48-51 kDa GenBank Accession Number: BC000459 Gene Symbol: POLD2 Gene ID (NCBI): 5425 RRID: AB_2918344 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49005 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.