Proteintech, 29798-1-AP, NOM1 Polyclonal antibody

Size: 20ul / 150ul The NOM1 (29798-1-AP) by Proteintech is a Polyclonal antibody targeting NOM1 in WB, IHC, ELISA applications with reactivity to Human, mouse samples 29798-1-AP targets NOM1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, MCF-7 cells, SW 1990 cells Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Nucleolar protein NOM1, which contains an MIF4G domain and an MA3 domain, was first isolated from the bone marrow of children with acute myeloid leukemia. NOM1 is highly conserved in a variety of species, including in yeast and in humans. Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31423 Product name: Recombinant human NOM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-205 aa of NM_138400 Sequence: MAASRSAGEAGPGGSQGRVVRMKRRGGRGPRRGPAGGGEKALKRLKLAVEEFVHATSEGEAPGGCEGRGAPVSFRPGGRKSRKELRKEKRHLRKARRLQRTAGPEQGPGLGGRSGAEEASGHRQDTEERARPAPSRDPSPPRKPRPSRVKAKATAATAKTRPSAAATAAARKRALLAANEEEDREIRKLERCLGLNKRKKKDGSS Predict reactive species Full Name: nucleolar protein with MIF4G domain 1 Calculated Molecular Weight: 96KD Observed Molecular Weight: 96~100 kDa GenBank Accession Number: NM_138400 Gene Symbol: NOM1 Gene ID (NCBI): 64434 RRID: AB_3086164 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5C9Z4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.