Proteintech, 29827-1-AP, SLC5A8 Polyclonal antibody

Size: 20ul / 150ul The SLC5A8 (29827-1-AP) by Proteintech is a Polyclonal antibody targeting SLC5A8 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 29827-1-AP targets SLC5A8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, mouse kidney tissue, rat kidney tissue Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The sodium-coupled monocarboxylate transporter 1 (SMCT1; SLC5A8), belonging to the SLC5A family, is a 67-kDa protein that functions as a Na+-coupled electrogenic transporter for SCFAs. SLC5A mRNA and protein are expressed in healthy human, rat, and mouse colon. The protein is localized to the apical membrane of the colonocytes. Immunohistochemical studies revealed the selective localization of SMCT1 on the brush border in the villi of the terminal ileum and crypts of the colon in mice. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30183 Product name: Recombinant human SLC5A8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 461-518 aa of BC110492 Sequence: QIYPPLPERTLPLHLDIQGCNSTYNETNLMTTTEMPFTTSVFQIYNVQRTPLMDNWYS Predict reactive species Full Name: solute carrier family 5 (iodide transporter), member 8 Calculated Molecular Weight: 610 aa, 67 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC110492 Gene Symbol: SLC5A8 Gene ID (NCBI): 160728 RRID: AB_3086176 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N695 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.