Proteintech, 29846-1-AP, STK24 Polyclonal antibody

Size: 20ul / 150ul The STK24 (29846-1-AP) by Proteintech is a Polyclonal antibody targeting STK24 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 29846-1-AP targets STK24 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse lung tissue, HeLa cells, Jurkat cells, rat lung tissue, rat skin tissue, rat spleen tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Serine/threonine-protein kinase 24 (STK24), also named MST3, belonging to GCK subfamily of STE20-like kinases, acts on both serine and threonine residues and promotes apoptosis in response to stress stimuli and caspase activation (PubMed: 10644707, PMID:12107159). STK24 and STK25 operate in the same cardiovascular development pathway with programmed cell death 10 (CCM3) (PMID: 20332113). It regulates axon outgrowth in forebrain neurons (PubMed: 17114295). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31519 Product name: Recombinant human STK24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 320-443 aa of NM_003576 Sequence: SDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH Predict reactive species Full Name: serine/threonine kinase 24 (STE20 homolog, yeast) Calculated Molecular Weight: 49KD Observed Molecular Weight: 50 kDa GenBank Accession Number: NM_003576 Gene Symbol: STK24 Gene ID (NCBI): 8428 RRID: AB_2923614 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6E0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.