Proteintech, 29890-1-AP, SNIP/p140Cap Polyclonal antibody

Size: 20ul / 150ul The SNIP/p140Cap (29890-1-AP) by Proteintech is a Polyclonal antibody targeting SNIP/p140Cap in WB, ELISA applications with reactivity to Human, mouse, rat samples 29890-1-AP targets SNIP/p140Cap in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SNIP, also named SRC kinase signaling inhibitor 1 (SRCIN1) and p140 Cas-associated protein (p140CAP), contains two regions of highly charged amino acids, two proline-rich regions, and two coiled-coil domains. SNIP plays a role in SRC inactivation and acts as a tumor suppressor gene in cancers. MiR-32 suppresses the expression of SNIP, thereby suppressing proliferation and epithelial-mesenchymal transition (EMT) of human liver cancer cells (PMID: 28550679). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31857 Product name: Recombinant human SNIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1011-1182 aa of Sequence: RSFPSSHGLTTTRTGEVVVTSKKDSAFIKKAESEELEVQKPQVKLRRAVSEVARPASTPPIMASAIKDEDDEDRIIAELESGGGSVPPMKVVTPGASRLKAAQGQAGSPDKSKHGKQRAEYMRIQAQQQATKPSKEMSGSNETSSPVSEKPSASRTSIPVLTSFGARNSSIS Predict reactive species Full Name: SNAP25-interacting protein Calculated Molecular Weight: 127 kDa Observed Molecular Weight: 145 kDa Gene Symbol: SNIP Gene ID (NCBI): 80725 RRID: AB_3086180 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9C0H9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.