Proteintech, 29958-1-AP, cGAS Polyclonal antibody

Size: 20ul / 150ul The cGAS (29958-1-AP) by Proteintech is a Polyclonal antibody targeting cGAS in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 29958-1-AP targets cGAS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells, Sp2/0 cells Positive IHC detected in: human placenta tissue, human lung tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information cGAS (cyclic GMP-AMP synthase) is a cytosolic DNA sensor that serves to mount an immune response against the invasion of microbial pathogens such as viruses. cGAS normally resides as an inactive protein in the cell. Upon binding to DNA, cGAS undergoes a conformational change to an active state and produces the second messenger cyclic GMP-AMP (cGAMP) from ATP and GTP, which is subsequently detected by the cyclic-dinucleotide sensor STING, an ~40 kDa dimeric transmembrane protein at the endoplasmic reticulum (ER). cGAS not only is found in the cytosol but has a multifaceted cellular distribution that involves localization at the cell membrane and in the nucleus (PMID: 32424334). The calculated molecular weight of cGAS is 58 kDa. With post-translational modification, the MW of cGAS will be migrated to 70 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31677 Product name: Recombinant mouse cGAS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 350-507 aa of BC145651 Sequence: KNAKDGNSFQGETWRLSFSHTEKYILNNHGIEKTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLECLRTEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPIFDKL Predict reactive species Full Name: RIKEN cDNA E330016A19 gene Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC145651 Gene Symbol: cGAS Gene ID (NCBI): 214763 RRID: AB_2935491 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8C6L5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.