Proteintech, 29978-1-AP, HOXA9 Polyclonal antibody

Size: 20ul / 150ul The HOXA9 (29978-1-AP) by Proteintech is a Polyclonal antibody targeting HOXA9 in IHC, IP, ELISA applications with reactivity to human samples 29978-1-AP targets HOXA9 in IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: HEK-293 cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Homeobox protein Hox-A9 (HOXA9) also known as HOX1G,a member of HOX family belonging to the HOXA cluster, is often studied in acute myeloid leukemia (AML), which is linked to proliferation, differentiation, and progenitor self-renewal maintenance. It is located in nucleoplasm and functions as a critical regulator of hematopoiesis, essential for the maintenance of hematopoietic stem cells and their differentiation into myeloid lineages (PMID: 34743404). Many post-transcriptional events including microRNAs, long non-coding RNAs, and epigenetic modification could also determine HOXA9 protein level and function (PMID: 36376832). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32309 Product name: Recombinant human HOXA9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-199 aa of BC010023 Sequence: VYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAAN Predict reactive species Full Name: homeobox A9 Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC010023 Gene Symbol: HOXA9 Gene ID (NCBI): 3205 RRID: AB_3086202 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31269 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.