Proteintech, 30010-1-AP, ITGBL1 Polyclonal antibody

Size: 20ul / 150ul The ITGBL1 (30010-1-AP) by Proteintech is a Polyclonal antibody targeting ITGBL1 in WB, ELISA applications with reactivity to human samples 30010-1-AP targets ITGBL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MDA-MB-231 cells, OVCAR-3 cells, SKOV-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information Integrin beta-like protein 1 (ITGBL1), also named as TIED or OSCP, is a secreted protein that contains ten tandem EGF-like repeats strikingly similar to those found in the cysteine-rich "stalk-like" structure of integrin beta subunits (PMID: 10051402). ITGBL1 participates in the regulation of fibrogenesis via interactions with transforming growth factor beta 1 (PMID: 28262670). ITGBL1 is also involved in the development and metastasis of many tumors (PMID: 32211321; 29772438; 26060017; 31190876). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31989 Product name: Recombinant human ITGBL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 246-374 aa of BC036788 Sequence: VCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGV Predict reactive species Full Name: integrin, beta-like 1 (with EGF-like repeat domains) Calculated Molecular Weight: 494 aa, 54 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC036788 Gene Symbol: ITGBL1 Gene ID (NCBI): 9358 RRID: AB_3086208 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95965 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.